Thymosin Alpha-1

POPULAR

Blog Posts

Peptides vs Proteins

July 3, 2025

What are the Differences? Peptides and proteins, while similar in many regards, have several key differences that are important to understand. Oftentimes the terms “peptide”

Read More »
[the_ad_group id="17"]

AOD9604

August 20, 2025

What is AOD9604? AOD9604 is a modified version of fragment 176-191, which is itself a smaller, modified piece of human growth hormone (HGH). AOD9604 was

Read More »

MK-677 Dosage, And Results

September 2, 2025

MK-677, also known as Ibutamoren, is a growth hormone secretagogue that is used to increase the levels of growth hormone (GH) and insulin-like growth factor-1

Read More »
[the_ad_group id="17"]
[the_ad_group id="356"]
[the_ad_group id="356"]

POPULAR

Peptide pages

VIP

VIP (VASOACTIVE INTESTINAL PEPTIDE) CIRS TREATMENT PEPTIDE Molecular Formula: C147H237N43O43S Molecular Weight: 3326.831 g/mol Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 DESCRIPTION Vasoactive intestinal polypeptide (VIP) is a naturally produced

BREMELANOTIDE PT 141

BREMELANOTIDE PT 141 LIBIDO AND ERECTIONNEUROPEPTIDE Molecular Formula: C50H68N14010 Molecular Weight: 1025.2 Sequence: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH DESCRIPTION Bremelanotide(PT-141) was developed from the peptide hormone Melanotan II. In

CJC 1295

CJC 1295 GROWTH HORMONE RELEASING Molecular Formula: C165H269N47O46 Molecular Weight: : 3647.15 Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-LeuLeu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 DESCRIPTION CJC 1295 stimulates growth hormone release via binding to the

[the_ad_group id="356"]

POPULAR

peptides

[the_ad_group id="17"]
[the_ad_group id="17"]