Research peptides are a class of compounds that are similar to natural peptides found in the body. They are often used in scientific research to

VIP (VASOACTIVE INTESTINAL PEPTIDE) CIRS TREATMENT PEPTIDE Molecular Formula: C147H237N43O43S Molecular Weight: 3326.831 g/mol Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 DESCRIPTION Vasoactive intestinal polypeptide (VIP) is a naturally produced

TESAMORELIN GH RELEASING HORMONE Molecular Formula:C221H366N72O67S Molecular Weight: 5135.77 Sequence: trans-hexenoyl-acid-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-LeuGln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 DESCRIPTION Tesamorelin is a growth hormone releasing hormone analog that increases IGF-1levels in men