[the_ad_group id="356"]
[the_ad_group id="356"]
POPULAR
Peptide pages
MOTS-c
MOTS-c Molecular Formula: C101H152N28O22S2. C2HF3O2. Molecular Weight: 2288.6 g/mol Sequence: MRWQEMGYIFYPRKLR DESCRIPTION Human mitochondrial DNA (mtDNA) encodes 37 known genes, including 2rRNAs, 22 tRNAs and
Research Peptides Legality
Research peptides are a class of compounds that are similar to natural peptides found in the body. They are often used in scientific research to
VIP
VIP (VASOACTIVE INTESTINAL PEPTIDE) CIRS TREATMENT PEPTIDE Molecular Formula: C147H237N43O43S Molecular Weight: 3326.831 g/mol Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 DESCRIPTION Vasoactive intestinal polypeptide (VIP) is a naturally produced
[the_ad_group id="356"]