VIP

POPULAR

Blog Posts

History Of Aminophylline

Aminophylline is a medication that belongs to a class of drugs called xanthine derivatives. It is a combination of theophylline and ethylenediamine and is used

Read More »
[the_ad_group id="17"]

Research Peptides

What are Research Peptides? Research Peptides Simply, research peptides are any peptides that are used in scientific research. In recent years, peptides have gained recognition

Read More »
[the_ad_group id="17"]
[the_ad_group id="356"]
[the_ad_group id="356"]

POPULAR

Peptide pages

EPITALON

EPITALON BIOREGULATOR Molecular Formula : C16H24N4O10 Molecular Weight : 432.4 g/mol Sequence: H-Ala-Glu-Asp-Gly-O DESCRIPTION Epithalon (also known as Epitalon or Epithalone) is the synthetic version

AOD 9604 + HA

AOD 9604 + HA Molecular Formula:C78H123N23O23S2 Molar Weight: 1815.1 g/mol Sequence: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-lle-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-LysThr-Glu-Thr-Gin-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thy-lleGlu-Gin-Glu-Lys-Gin-Ala-Gly-Glu-Ser DESCRIPTION AOD9604 is a GH fragment which comprised the last 16 amino acids

VIP

VIP (VASOACTIVE INTESTINAL PEPTIDE) CIRS TREATMENT PEPTIDE Molecular Formula: C147H237N43O43S Molecular Weight: 3326.831 g/mol Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 DESCRIPTION Vasoactive intestinal polypeptide (VIP) is a naturally produced

[the_ad_group id="356"]

POPULAR

peptides

[the_ad_group id="17"]
[the_ad_group id="17"]