[the_ad_group id="356"]
[the_ad_group id="356"]
POPULAR
Peptide pages
Best Practices: Semaglutide Dosing 101
Semaglutide Dosing Semaglutide must be prescribed by a doctor. We in no way condone the use of Semaglutide without a doctors supervision. The below information
VIP
VIP (VASOACTIVE INTESTINAL PEPTIDE) CIRS TREATMENT PEPTIDE Molecular Formula: C147H237N43O43S Molecular Weight: 3326.831 g/mol Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 DESCRIPTION Vasoactive intestinal polypeptide (VIP) is a naturally produced
AMMONIUM TETRATHIOMOLYBDATE
AMMONIUM TETRATHIOMOLYBDATE Molecular Formula: H8N2M0S4 Molecular Weight: 260.28 g/mol Sequence: Non-Peptide DESCRIPTION Ammonium tetrathiomolybdate (TM) was developed as a non-toxic treatment for Wilson’s disease, which
[the_ad_group id="356"]