[the_ad_group id="356"]
[the_ad_group id="356"]
POPULAR
Peptide pages
VIP
VIP (VASOACTIVE INTESTINAL PEPTIDE) CIRS TREATMENT PEPTIDE Molecular Formula: C147H237N43O43S Molecular Weight: 3326.831 g/mol Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 DESCRIPTION Vasoactive intestinal polypeptide (VIP) is a naturally produced
Leuphasyl
Leuphasyl Molecular Formula: C29H39N5O7 Molecular Weight: 569.659 g/mol Sequence: Tyr-D-Ala-Gly-Phe-Leu DESCRIPTION Leuphasyl, pentapeptide-18, is a five amino acid peptide that reduces the depth of wrinkles
5-amino-1MQ
5-amino-1MQ Molecular Formula: C10H11N2 Molecular Weight: 159.21 g/mol Sequence: Non-Peptide DESCRIPTION 5-amino-1MQ is a small, selective, membrane permeable molecule that is an inhibitor of nicotinamide
[the_ad_group id="356"]